PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01934.1.p
Common NameEUGRSUZ_I01934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 239aa    MW: 27035.2 Da    PI: 8.5187
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01934.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.4e-1887138556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Eucgr.I01934.1.p  87 KRLSLEQVKALEKSFEIGNKLEPERKIQLARALGLQPRQIAIWFQNRRARWK 138
                       45889**********************************************9 PP

2HD-ZIP_I/II128.42.9e-4184174191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       e+k+rls eqvk+LE+sFe  +kLeperK +lar+Lglqprq+a+WFqnrRAR+ktkqlE+dye+Lk++++ lk+en++L++++e+L++el
  Eucgr.I01934.1.p  84 ERKKRLSLEQVKALEKSFEIGNKLEPERKIQLARALGLQPRQIAIWFQNRRARWKTKQLERDYEVLKKQFEVLKAENDALHAQNEKLHAEL 174
                       69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-1961141IPR009057Homeodomain-like
SMARTSM003892.0E-1883144IPR001356Homeobox domain
PROSITE profilePS5007116.56884140IPR001356Homeobox domain
SuperFamilySSF466891.97E-1984142IPR009057Homeodomain-like
CDDcd000861.57E-1585141No hitNo description
PfamPF000462.1E-1586138IPR001356Homeobox domain
PRINTSPR000311.2E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5120136IPR000047Helix-turn-helix motif
PfamPF021831.6E-14140180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAFPPPSASS AASFMFQAHH HHHQEDPLPS IIPLNHSNGD VVNNVPFLMK RSMSFSGADH  60
NQRSCGGGDD DDLSDDGSQL LLGERKKRLS LEQVKALEKS FEIGNKLEPE RKIQLARALG  120
LQPRQIAIWF QNRRARWKTK QLERDYEVLK KQFEVLKAEN DALHAQNEKL HAELLVLKGR  180
DTNEAPSNLK KEIERSYWSN GSENSSDINL DISRTSVMNS PVSSSQFSNK HHFTSSRPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01934.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029293.11e-176PREDICTED: homeobox-leucine zipper protein ATHB-20-like
SwissprotQ8LAT07e-73ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLA0A059AQY51e-177A0A059AQY5_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0017s11800.11e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.13e-60homeobox protein 20